PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538712.1_FGP102
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 468aa    MW: 51824 Da    PI: 4.4372
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538712.1_FGP102genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS162.53.6e-50483872354
               GRAS   2 velLlecAeavssgdlelaqalLarlsel.....aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                         +lLl+ Aeav++gd  la+ + +rl +       + +++++ Rla +f ++L++r+++ ++++y+   p++ +    s ++ ++++ ++  
  KN538712.1_FGP102  48 SDLLLAGAEAVEAGDSILASVAFSRLDDFlsgipENGAASSFDRLAYHFDQGLRSRMSSASTGCYQ---PEPLP----SGNMLVHQIIQD-- 130
                        679***********************998554333334479******************9999994...44444....233444455555.. PP

               GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                          +kf+h+t+NqaIl+a+ g+  vH++D++i++G+QW +L+  La    g  s+R+T++   +  +  +  ++ + L++fA++l++pf++n 
  KN538712.1_FGP102 131 --VKFAHFTTNQAILDAIIGDMDVHVVDLNIGEGIQWSSLMSDLAR--CGGKSFRLTAITTYADCNPSTHDTVVRLLSEFADSLELPFQYNS 218
                        ..6******************************************7..4668*********7777888899999999*************** PP

               GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe.......adhnsesFlerflealeyys 265
                        + +++ +  el+++  + + +++V++    ++    ++s+ +  + +L +vk+l+Pk+vv +e++       a+ +s+sF+e f+eal++++
  KN538712.1_FGP102 219 ICVHDED--ELHAFFEDCKGSVIVSCDTTSMYYK--PLSTLQ--SLLLVCVKKLQPKLVVTIEEDlvrigrgASPSSASFVEFFFEALHHFT 304
                        8666444..45778777799******99776665..666555..79*******************7665553344666************** PP

               GRAS 266 alfdsleaklpres..eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                        ++f+s+++ +   +     + vE ellg++i++ v + g+ r+e +      +e l   GF + +ls  + +qa++l+  ++ + + v  +
  KN538712.1_FGP102 305 TVFESMASCFIGSNyePCLRLVEMELLGPRIQDFVVKYGSVRVEANA-----SEVL--EGFMACELSACNIAQARMLVGLFN-RVFGVVFK 387
                        ******66655444478899*********************999888.....5555..5********************999.44555544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098527.11921388IPR005202Transcription factor GRAS
PfamPF035141.2E-4748387IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MVLDSNELHQ HDAPDVDVSI NCDDRIFGQE SVNLAAIQEE LLEEDSLSDL LLAGAEAVEA  60
GDSILASVAF SRLDDFLSGI PENGAASSFD RLAYHFDQGL RSRMSSASTG CYQPEPLPSG  120
NMLVHQIIQD VKFAHFTTNQ AILDAIIGDM DVHVVDLNIG EGIQWSSLMS DLARCGGKSF  180
RLTAITTYAD CNPSTHDTVV RLLSEFADSL ELPFQYNSIC VHDEDELHAF FEDCKGSVIV  240
SCDTTSMYYK PLSTLQSLLL VCVKKLQPKL VVTIEEDLVR IGRGASPSSA SFVEFFFEAL  300
HHFTTVFESM ASCFIGSNYE PCLRLVEMEL LGPRIQDFVV KYGSVRVEAN ASEVLEGFMA  360
CELSACNIAQ ARMLVGLFNR VFGVVFKKIS LLMVYCIFLG KNDLREPNKV IWSSLAAGCG  420
SHGIVVLAFY AADKLLEFKP KGIETYIHPA VERAHFHKED IMWQEYEN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1205340.0AC120534.5 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBa0084A20, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankCP0126190.0CP012619.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 11 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617104.10.0PREDICTED: nodulation-signaling pathway 2 protein
TrEMBLI1QXX40.0I1QXX4_ORYGL; Uncharacterized protein
TrEMBLQ53PL90.0Q53PL9_ORYSJ; GRAS family transcription factor containing protein
STRINGLOC_Os11g06180.10.0(Oryza sativa Japonica Group)
STRINGORGLA11G0036600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP76843250
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08250.11e-26GRAS family protein